PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g062690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 816aa    MW: 88988.7 Da    PI: 6.317
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g062690.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.83.4e-1304538122374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs+++le+a++lL ++s+l++p+g++ qR+aayf eA++arl++s+ ++y+alp++  ++++s + ++a+++f+ +sP++kfsh+
  Csa09g062690.1 453 LTLLLQCAEAVSADNLEEANKLLLEISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHF 547
                     579******************************************************************************************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+e+ vHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+l++tg+rL++fA++lg+pfef + +a+++ +l++
  Csa09g062690.1 548 TANQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGT----SMEALQATGKRLSDFADKLGLPFEFCP-LAEKVGNLDT 637
                     *****************************************************....***************************.59******** PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE
  Csa09g062690.1 638 ERLNVRKREAVAVHWLQ--HSLYDVTGSDAH----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVE 725
                     ****************9..999988888888....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll++ei+nv+a  g +r  + + +e+Wre+++++GFk ++l  +aa+qa lll +++sdgy++ +++g+l lgWkd +L+++SaW+
  Csa09g062690.1 726 QQLLSKEIRNVLAVGGPSRSGEVK-FESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASAWT 812
                     ******************888776.**************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.608426792IPR005202Transcription factor GRAS
PfamPF035141.2E-127453812IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MADSGDFNGG QPPHSPLRTT SSGSSSSNNR SGAPPPPPLV MVRKRLASEM SSNPDYNNPS  60
RPPRRASHLL DSNYNTLSPQ QQQQQPPSLA AATAVASQPN PPLSVCGFSG LPVFPSDRGG  120
GRNAMSVQPM EQDSSSSSAS PTVWVDAIIR DLIHSSTSVS IPQLIQNVRD IIFPCNPNLG  180
ALLEXPFFFI GDLMVRKRLA SEMSSNPDYN NPSRPPRRAS HLLDSNYNTV PPQQQQQQPP  240
SLAAATAVAS QPNPPLSVCG FSGLPVFPSD RGGGRNAMSV QPMEQDSSSS SASPTVWVDA  300
IIRDLIHSST SVSIPQLIQN VRDIIFPCNP NLGALLEYRL RSLMLLDPSS SSDPSPQSFE  360
PLYQISNNPS PPVTQHQQQH QHQQQQQQQQ QHKTPPPPPI QQQERENSST DAPPQPETVT  420
TTTATVTNTA EALRERKEEI KRQKQDEEGL HLLTLLLQCA EAVSADNLEE ANKLLLEISQ  480
LSTPYGTSAQ RVAAYFSEAM SARLLNSCLG IYAALPSRWM PQTHSLKMVS AFQVFNGISP  540
LVKFSHFTAN QAIQEAFEKE DSVHIIDLDI MQGLQWPGLF HILASRPGGP PHVRLTGLGT  600
SMEALQATGK RLSDFADKLG LPFEFCPLAE KVGNLDTERL NVRKREAVAV HWLQHSLYDV  660
TGSDAHTLWL LQRLAPKVVT VVEQDLSHAG SFLGRFVEAI HYYSALFDSL GASYGEESEE  720
RHVVEQQLLS KEIRNVLAVG GPSRSGEVKF ESWREKMQQC GFKGISLAGN AATQATLLLG  780
MFPSDGYTLV DDNGTLKLGW KDLSLLTASA WTPRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-504528114374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0563150.0AY056315.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
GenBankAY0808400.0AY080840.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
GenBankAY1139910.0AY113991.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010427091.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLD7LUR70.0D7LUR7_ARALL; Putative uncharacterized protein
STRINGAT3G54220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81642640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein